Dataset for protein adenoviridae of organism Human adenovirus 62

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
  :* :: .::.*     :* :  : *** .                                 *: . .:*    .  :
lme ssiladfn vlttma glkedr   cntgmmteltaslmnrrrperitwhelqqecrdei fmqdkf leliklhw

       170       180       190       200       210       220       230       240
 . .:*::* :::     * .**.  : .::*: * . :.    * :: :** ::      *:              : *
lnpde we afekyakia fa  kyglldsl ig aalfqgnga riids  faafgccma maagvmnmnsmifmnik 

       250       260       270       280       290       300       310       320
  :*:.   .::..::         ::  .  :* *  . ** .::. *:                     *  :: *  
lgd fngqlflandhitlhgcnffgfdfmaael g wski  ckffgc lgvvgrpksemsvkqcvfekcy apaae la

       330       340       350       360       370       380       390       400
*:.. :**                                                                        
 lhhcs  etgcfclvkgtasikhnvikgctdermynmltcdsgvchilknihvtshprkrwpsfennvlikchvhlgar

       410       420       430       440       450       460       470       480
                                                                     : **:*     
rgtfqpyqcnfsqtklllendafsrvnlngifdmdvsvykilrydetrsrvracecggrhtrmqpvaldle  l eahde

 . :* : ..* *: *
macs ldfpp e dl 
© 1998-2022Legal notice