Dataset for protein adenoviridae of organism Human adenovirus 60a

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepehpteqglhsglrghapveglgqaagtenlellastasssgsssstqtnihvggrneaghgrepeerpgpsvgrgag

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* ::  ::..     :* :  : *** .                                 *: . .:*    .  :
-nqVwtlypelsr-----tRrvvresSDGgs---------------------------------GlwrhwyGtpqsrtvy
lme ssilgdfnkvltsma glkedr   cntgmmteltaslmnrkrperitwhelqqecrdei fmqdkf leliklhw

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*::* :::     * .**.  : .::*: * . :.    * *: :**                         :. 
-tvkkDynEeikn-----LrpDCs-rvtktvNirHqsyis----EvVlhtLD-------------------------mss
lnpde we afekyakia fa  kyglldsl fg aclfqgnga r ids  kaafrccmmgmragvmnmnsmifmnfkf

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * .  ** *:.      ..:  *    ::.*  *   :* * .. ** .: . *:   . *                  
pGrttnGVmFvv------ssnttLsrgyilgFnnM--hvWrA-vrqRGqriynyWmlvvgrP------------------
n ekfa  a maflvdkwnqhmq hgcsffd aa cael g waki  ckflgc lgqpaa ksemsvkqcvfekcylgv

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                * : * . *: *: :* :.  ::                                         
----------------GllrLvrqTssLkhnMvqgmten-----------------------------------------
stegnarvrhcsslet cfc hkg am eee rkacddermynmltcdsgvchilknihvtshprkkwpvfennllikch

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *. ::*                                                                    
-----rRstlqP--------------------------------------------------------------------
mhlgap ggfd yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteel

       490       500  
....:....|....:....|..
               .* *: *
---------------sSgEetD
rpdhlvmactgtefsp e dl 
© 1998-2020Legal notice