Dataset for protein adenoviridae of organism Human adenovirus 60a

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
  :* ::  ::..     :* :  : *** .                                 *: . .:*    .  :
lme ssilgdfnkvltsma glkedr   cntgmmteltaslmnrkrperitwhelqqecrdei fmqdkf leliklhw

       170       180       190       200       210       220       230       240
 . .:*::* :::     * .**.  : .::*: * . :.    * *: :**                         :. 
lnpde we afekyakia fa  kyglldsl fg aclfqgnga r ids  kaafrccmmgmragvmnmnsmifmnfkf

       250       260       270       280       290       300       310       320
 * .  ** *:.      ..:  *    ::.*  *   :* * .. ** .: . *:   . *                  
n ekfa  a maflvdkwnqhmq hgcsffd aa cael g waki  ckflgc lgqpaa ksemsvkqcvfekcylgv

       330       340       350       360       370       380       390       400
                * : * . *: *: :* :.  ::                                         
stegnarvrhcsslet cfc hkg am eee rkacddermynmltcdsgvchilknihvtshprkkwpvfennllikch

       410       420       430       440       450       460       470       480
      *. ::*                                                                    
mhlgap ggfd yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteel

       490       500  
               .* *: *
rpdhlvmactgtefsp e dl 
© 1998-2022Legal notice