Dataset for protein E1B 19K of organism Human adenovirus 53

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepehpteqglhsglcshapvegmgeaagtenlellaytasssgsssstqtnihvggrneaghgrepeerpgpsvgrgag
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* :: .::**     :* :  : *** .                                 *: . .:*    .  :
-mdVwtiladfSK-----tRrlvedsSDGcs---------------------------------GfwrhwfGtplsrlvy
lnq sslypel  vltsma gvkrer   gntgmmteltaslmnrkrperitwhelqmecrdel lmqdky leqikthw
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*::* :::     * .**. :: .::*: * . :.    * *: :** ::      *       :  ::*:  *:
-tvkkDynEefen-----LfaDCsgll-dslNlgHqslfq----ErVlhsLDfsspgrttaG-------vafvvFlvdKw
lnpde we aikkyakia rp  kyivtktv ir acyisgnga v idt  kaafrccmm mragvmnmnsmi mnm f
                                                                       c        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            ..:  *    ::.*  *   :* *  . ** .: . *:   . *                        
------------sqntqLsrgyildFaaM--hlWrAwvrqRGqrilnyWliqpaaP------------------------
ngekfngvlfmanshmt hgcsffg nn caev g -ski  ckfygc mgvvgr ksemsvkqcvfekcylgvstegna
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          * : * . *: *: :* :.  ::                                               
----------GllrLhrqTsmLeeeMrqamden----------------------------------------------p
rvrhcssldt cfc vkg as khn vkgctdermynmltcdsgvchilknihvtshprkkwpvfennllikchmhlgar
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. ::*                                                                          
RsgldP--------------------------------------------------------------------------
 gtfq yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteelrpdhlv
                                                                                

       490      
....:....|....:.
         .* *: *
---------pSeEelD
mactgtefss g dt 
                
© 1998-2021Legal notice