Dataset for protein adenoviridae of organism Human adenovirus 39

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepghpteqglhpglrshapvegldqaagtenlellastasssgsssstqtnihvggrdegghgrepeerpgpsvgrgag

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* ::  :: *     :* :  : *** .                                 *: . .:*    .  :
-sqVwtlypelvK-----tRrvvresSDGgs---------------------------------GlwrhwyGtpqsrtvy
lmd ssilgdfs vltsma glkedr   cntgmmteltaslmnrkrperitwhelqiecrdev fmqdkf leliklhw

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*:.* :::     * .**.  : .::*: * . :.    * *: :** ::      *       :  ::*:  *:
-tvkkDysEeikn-----LrsDCs-rvtktvNirHqsyis----EvVvhtLDkstprrttmG-------vnsvvFmvmKw
lnpde we afekyakia fp  kyglldsl fg aclfqgnga r lds  faafgccma mragvmnmafmi lnd f

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :.             :    ::.*  *   :* *  . ** .: . *:                     *  :. *  
sqet------------tvsrgyilgFnnM--hlWrA-irqRGqriynyWm---------------------LqvsvpGnl
ngdkfngvlfmanshmqlhgcsffd aa caei g waki  ckflgc lgvvgrpksemsvkqcvfekcy apate la

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:.. :**                                                                        
RvrrqtSM------------------------------------------------------------------------
 lhhcs  etgcfclvkgtasikhnvvkgctdermynmltcdsgvchilknihvtshsrkkwpvfennllikchmhlgar

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     : **:*     
---------------------------------------------------------------------vtEEmRpdmlv
rgtfqpyqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldle  l eahde

       490      
....:....|....:.
 . :* : ..* *: *
nprtGte-ssSgEetD
macs ldfpp e dl 
© 1998-2020Legal notice