Dataset for protein adenoviridae of organism Human adenovirus 25

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepghpteqgihpglrshapvegldqaagtenlellastasssgsssstqtnihvggrneaghgrepeerpgpsvgrgag

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* :: .::**     :* :  : *** .                                 *: . .:*    .  :
-nqVwtlypelSK-----tRrvvresSDGgs---------------------------------GlwrhwyGtpqsrtvy
lmd ssiladf  vltsma glkedr   cntgmmteltaslmnrkrperitwhelqmecrdei fmqdkf leliklhw

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*::* :::     : .**.  : .::*: * . :.    * *: :** ::      *       :  ::*:  *:
-tvkkDykEeikn-----lrpDCs-rvtktvNlrHqsyis----EvVlhtLDkssprrttmG-------vnsvvFmvmKw
lnpde we afekyakiaifa  kyglldsl ig aclfqgnga r ids  faafgccma mragvmnmafmi lnd f

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :.             *    ::.*  *   :* *  . ** .: . *:   . *                        
sqet------------tLsrgyilgFnnM--hvWrA-srqRGqriynyWmlvvgrP------------------------
ngdkfngvmfmanshmq hgcsffd aa cael g wiki  ckflgc lgqpaa ksemsvkqcvfekcylgvstegna

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          * : * . *: *: :* :.  ::                                               
----------GllrLvrqTssLkhnMvqgmten----------------------------------------------r
rvrhcsslet cfc hkg am eee rkacddermynmltcdsgvchilknihvtshprkkwpvfennllikchmhlgap

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. ::*                                                                          
RstlqP--------------------------------------------------------------------------
 ggfd yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteelrpdhlv

       490      
....:....|....:.
         .* *: *
---------sSgEetD
mactgtefsp e dl 
© 1998-2020Legal notice