Dataset for protein E1B 19K of organism Human adenovirus 23

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepghpteqglhsglrshapveglgqaagtenlellastasssgsssstqtnihvggrneaghgrepeerpgpsvgrgag
   e        p           d                                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* ::  ::.*     :* :  : *** .                                 *: . .:*    .  :
-nqVwtlypelsK-----tRrvvresSDGgs---------------------------------GlwrhwyGtpqsrtvy
lme ssilgdfn vlttma glkedr   cntgmmteltaslmnrkrperitwhelqqecrdei fmqdkf leliklhw
  d a   a                                                                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .:*::* :::     * .**.  : .::*: * .                             ::: . :  :::. 
-tvkkDyeEeikn-----LrpDCs-kltktvNirHqs-----------------------------vmqmrvmismnmss
lnpde wn afekyakia fa  kygildsl lg acyisgngaevmidtldksafrccmmgmraglfnenslhfldfkf
       k                        f                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * .  ** *:.      ..   *    ::.*  *   :* *  . ** .: . *:                     *  
pGrttnGVlFvv------sshttLsrgyilgFnnM--hvWrA-arqRGqriynyWm---------------------Lqv
n ekfa  a mtflvdkwnqnmq hgcsffd aa cael g wvki  ckflgc lgvvgrpksemsvkqcvfekcy gp
           a        d                      i                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:: *  *:.. :*:                                                                  
stpGnlRvrrqtSm------------------------------------------------------------------
aae la lhhcs letgcfclvkgtasikhnvvkgctdermynmltcdsgvchilknihvtahsrkkwpvfennllikch
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           : **:
---------------------------------------------------------------------------vtEEm
mhlgarrgtfqpyqcnfsqtklllendafsrvnlngifdmdvsvykilrydetrsrvracecggrhtrmqpvaldle  l
                                                                                

       490       500  
....:....|....:....|..
*      . :* : ..* *: *
RqdmlvnprtGte-ssSgEetD
 pahdemacs ldfpp e dl 
                      
© 1998-2021Legal notice