Dataset for protein adenoviridae of organism Human adenovirus 21a

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                    :*     :* .: *** . **                                 .**:.:
mdppnplqqgirfgfhsssfm nmagle ednl   aea  gssrdtetptghasgsgggaaggqsesrpgpsgd  adf

        90       100       110       120       130       140       150       160
:                                               :*.                             
fpelrrvltrstssgqdrgikrernpsgnnsrtelalslmsrrrpetvf fevqsegrdevsilqekysleqlktcwlep

       170       180       190       200       210       220       230       240
         : *.: :* .::**               :  * ::* .             **:.       :*: .:. 
eddwevaigdl kisf idkd  itkkinirnacyisgeea kii dqdktafrccmmgmw  lfeaeavtfl igfkad

       250       260       270       280       290       300       310       320
  : :: : : .   . .: ..* .  :: *    :*   *   ::                                  
fkegilfmadfklighgaaafa lnfclda gqvsi gch sacwiadsgrvksqlsvkkcmfercnlgilnegearvrh

       330       340       350       360       370       380       390       400
                                                .*.:  ...*                      
caatetgcfilikgnasvkhnmicghsnerpyqmltcagghcnilatvf aaaarkk pvfehnvitkctmhiggrrgmf

       410       420       430       440       450       460       470       480
     : ..:..:*:  ... :.::**:     :  :*  :: : . **                               
mpyqckanhmkti dpdafqplgla  fdhnialpai eeddqednp  cecggkharfqpvcvdvtedlrpdhlvlact

    * .    :
gaef ldgeeed
© 1998-2022Legal notice