Dataset for protein Bcl-w of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------matpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlh
hlsslpliaar---------------------------------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssggwa-eft
----------------------------------------------------------------------------l---
                                                                           e  ai

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        *** .*.*               ** ..*            *:: .* *  ** .                 
alygdgmlEEArrLrE---------------GNwgsV------------RtvyvGnVdyGAtvt----------------
------ae   ek k lqnevekqmnmsppp  aap imsieekmeada silt a al  laeeleahfhgcgsvnrvt
karvre                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvdfkafiyssltqvipkrtnrpgisttdrgfpraryrar
                                                                                

       330       340       350       
....:....|....:....|....:....|....:..
                                     
-----------------------------vgaffask
ttnynssrsrfysgfnsrprgrvyrsrar--------
                         gg  atswyspy
© 1998-2022Legal notice