Dataset for protein Mcl-1 of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGESAGASPPAALTPDARRVARPP
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSL
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************** :  :     
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGwvrkv-----
                                                                      mlcgldikne

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            : . *  .*                     ::.*   :. .  .      *.*:              
------------vpsrGvtrW---------------------qqsCieplcrsiws------RsWl--------------
ddvkslsrvmvhlfcd prn grivtlisfgafvakhlktinhek aagfaecctdvlvrtk d fvkqrgwdgfveffh

       330       340       350
....:....|....:....|....:....|
                   *:.  :* *  
-------------------GvsnklAyL--
vedleggirnvllafagva igagi l ir
© 1998-2020Legal notice