Dataset for protein BCL-2-like of organism Poecilia reticulata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
       aswr   --e- -pshia       k piq ll n          ep dstaardaagdggmeeedtlrdnih
         sm         k              c  i                             kddaag   had

        90       100       110       120       130       140       150       160
    ..  ..              ..      .:   : :.   .   *  *              .:  *:::      
etfsdpdeap-------q--etdapapsvskvtmddttrdfirrftqs ns hstf-kisptkllqsfrt medvlskhr
lrcrnthn  pvrsr g-r ksqg tmeepasa krl q v lqhsar kh aqq  hhcgdd chnlen l        
 d n       rnqq a a        d   a    a e   al q a hd  lg  d   a       k          

       170       180       190       200       210       220       230       240
                            :. .*  ****:*.:.:*.. :.     .     .                 
yayngmlsklaldnqpdnmgfvtevaesvv-k -t    v gmvt aaivaq-ck-kqmeectslnpgpdsgkqqelqqe
                            m r  hf      a      a  -e--q nlr q gk               
                              g                   d    e     a                

       250       260       270       280       290       300       310        
      : : :: **  .   *: .:..*: * .              . ::     : *:.     :          
tvscraiaqemsv  darlnp vakqgs dr asyaygqnaaaesrrsqesfvnfllla vavllglivvsiiaqksl
      lv t ad  ekqkk  iee     h cnl lngdevsqg smktnkva    mslv fa lgmff k  k
                 hie              i f a     d  f    k         g     a         
© 1998-2020Legal notice