Dataset for protein BCL-2-like of organism Paramormyrops kingsleyae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
           :          : .                                     :      .          
 anispkdsan mvsyvscpgihn  nqhhgiqcl     a nl caelkaksdd   n pe respncasqgdkaecq 
  ldnl  a g  mimnf   a k  liegfa                            l  g efh  pkdag  a  
              d        h  k a                               a  a  ce   ea a     

        90       100       110       120       130       140       150       160
                   .     *                                     .  .          .*.
vtat---g--raratvseggsl-tt dgtppdygpmltfsrsgvemlsqetselittflrtlssrsatp-slnraysa k
   klvr-gsispngtgddapv ss   dl ac kicg pnra    d   h   g  faevr pp rldrhhkllrt  
   hepc  qh a  seaa    eq                                     h ac qfap ae hp   
   a      a                                                   e                 

       170       180       190       200       210       220       230       240
     .   .   :. :  :* :        .   * : :* *   ****:..:. **. :*    :      *  :  .
lsvetfvlkhsidyndlikk slnqssddttvvet anri r ktt    vagfve  avl kyckntgrssc gnvvsr
eagd iigmflf   e hge e dkrg qrr ikk i  l    i       a l    tm   s dr qgpq eh gkq
d  a   f  k       e      q   m    a                   i    e       h  en   d  h 
       e                 a                                                 a    

       250       260       270       280       290       300        
:: **    . *:  : .*: *.:::  :           .       :       :           
iss  dnpiqq lntqna eg adfyyqdataetrrvqarvqqygptvft-vtgvalmsl-aqyfkrq
  e  ngnlhn  lk k   a t   hnqrps-s-lrnvn kpselggle ig kv crt sk  tkl
  c   ee  d   e            m  g  l  qm c hka k a a hd g   m   a    k
                           k     g   k   af  c            f         
© 1998-2022Legal notice