Dataset for protein Mcl-1 of organism Otolemur garnettii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
     :**                     :*** .***: ***.*: . ***** *.*  *****:****.****** :*
pigael  vtatptrllffaptlraapree   pa   ik   d lagc     g q ag     f    g      gs 

       170       180       190       200       210       220       230       240
******* *******.**:*******.** **                                                
       e       r  l       r  a  akdakpmgragaasrkaletlrrvgdgvqrnhetafqgmlrkldikne

       250       260       270       280       290       300       310       320
:*::******.**** ********:*** **.*******:****. *:** *.*:******* ****************:
d ik      a    d        m   s  a       s    gc e  a n a       p                h

       330       340       350
l    ggi                 a    
© 1998-2020Legal notice