Dataset for protein BCL-2-like of organism Otolemur garnettii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
                                                                . :             
                          lpde   pa   ik   d lagm---grrsqttgalatkliq vsrirstsgd 
                                                cattcemepsh  i q   h a qgqq eaa 
                                                  ha aka ia    m   e   n p  d   
                                                      g        a                

       170       180       190       200       210       220       230       240
                                                       .                   ..   
    aelrstp eaeasalgtprqqnenpptparerdpgnkdtk ttrtgpstvttt     r-eqnamfrsqaiiqqsh
      dpge    a e d lf ail ii rh  dqa a gard mspld rsrk m     pe-klva e m g  lnf
                                          n  akd a pagi a     ea da   a   d  k  
                                              g    g ae       d  a              

       250       260       270       280       290       300       310       320
                     .  :    :  .   ****::::. *.. :                             
wt----ltvy-hi-tfsdrtrleqmmvhvlrynqtl    vmafi- aaavlvhppvealktinqe-ylrplsesivria
kstlqn-srv dvsnenrynvvtt snkm qg pr     l  ivv   vmaqr     rrskqdkgqiqqrqvndtqvy
epf dgynqk  lkide qki   kae  ii          t   t  ak       e     lde gide sntq
 ed aeflge      d ig    d                  e   i                 c    aa  gddc
  c  a ia                 a                  a                              d   

       330       340       350       360       370       380       390       400
          :      *:  . **      *                          :          .          
q--va--ntrimrtkrv lqsnr  wrcqha tqfyyvsdrylyrfsregnwagvlntftafvglcalgalg--fg-klt
lrltylvssh hnytpt  rqs      e e pkklstpmpsifdrl     wlscrn fvvraiarcvpgfvf--ys  
keistf erf egqhgp  he       a   ca  rlnlnpea  k     vfm kl egtlka fmi i t mwtr  
e  ae  ae  a    e  ed               hdkagl          gci gf cea    e a   i  as   
a                   a               e g                                     h   
© 1998-2020Legal notice