Dataset for protein BCL-2-like of organism Oryzias melastigma

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
             ..  :   :                .   *:                                    
mdgfsaqkm-ssrnrhllvfaitpscgctalfgkagsrqanv v-----------daseqmkrp--------kspyaarr
         smhc t qv v           d lml cds  sllvptespgr--agevgeeeststtc         
          cg      a                 l       nhiklnddg q           reaha         

        90       100       110       120       130       140       150       160
                           *   .                          .: .   .*   :.   :    
fhdddg-s------g-cdn-v-lpqsl sttdttefltnffrnyvglsqsrhreskyidtvrstlr tadeferayntlf
       -fvgssp-tppl p rkkqc psen                         a  m elaq setqyqp  aqga
         n  ed q        ap  cca                             i  a k       l   la 

       170       180       190       200       210       220       230       240
. :    :       . :  * :::. *   ****:..*:.* ..:. :  *.                    . : : :
sdfrse-nidddtayqffrs annmvr nti    vag lv vavvaleck rtmgppgldlgreaapgpvlcsliaqei
qn hk-l cg alc  nlkn ld   k ghl                r  r qndtn                qalv tv
      f           ek      g e                        e  e                       

       250       260       270       280       290       300       310       320
  :*      *: .:..*: * ::     .          :.   .      . *   .                     
cvf dnqisd iqnqgs er aql-gqsraeesrssqesmnkllaaavtaltav vall--qk-lwqdmtscrtnlsknk
am  gghkqe mle   c ckiy--egt re  qdstl  atf gmslal l tfsfvrpy i       h       
 d   ed k   h              da   a  f   f       aa    g     qgk                  

© 1998-2020Legal notice