Dataset for protein Bcl2l10 of organism Oryzias latipes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************************** **************
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGpDLCSSLRKVMEELV
                                                                 q              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************.**************************************
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVApGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
                                         a                                      

       170       180       190  
....:....|....:....|....:....|..
********************************
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
                                
© 1998-2020Legal notice