Dataset for protein Mcl-1 of organism Myotis lucifugus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                       * ***:.  
mfgpkrnafiglnlhcggavgglwrqrslhllqeggpcpqesgagretgtvigwsagaspqatlardpgrv p   igge

        90       100       110       120       130       140       150       160
**     *:*   * .   *.**    * ******** ***. *****  *.******:******* ** **********
  dghaa a ggc fplas g  eelg a        e   dg     lg q      l       e  g          

       170       180       190       200       210       220       230       240
******:  :   **:*..:  : :**.* .   ** ... :     **...    .:* ** *               .
      delfrqs  i pqhleeaa  k akplg  aaggrkaletl  aadcsgrnh m  l elgpralclvrdelap

       250       260       270       280       290       300       310       320
 . :. :.. :.:   **:                .*: ::.:  *: *  .  * :   : . * ..:  .   *****
egedndepglealsaa  dgvtngrivthffwclcq ikainhes fe laedg allsgaekg etknrchgfk     

       330       340       350   
**:*******:********* *******.****
  h       i         v       a    
© 1998-2022Legal notice