Dataset for protein BCL-2-like of organism Mustela putorius furo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                g keegaviefspgihnrlslgsdgagvmr-s
                                                  ga a laaa adaeapag apaa am hpp
                                                                             a g

        90       100       110       120       130       140       150       160
        :                                                               .       
smrpsglqiltkpphhlaqgrqrra pfeda enaad immplsymegppainllpsphrlpspssp-gsspasvtrpv-
rlfgr an aq  ig c fe  p                egk e  d ae e ggk halad lepnteprh acpggsa
piaee  a  m   e       h                                         alg  lae     da 
 e a                                                             ca  a a     a  

       170       180       190       200       210       220       230       240
                                                    :*   : .                    
-----vleeeedelyrqsleiisrylreqatgakdakplggpgaasrkallav rvlesvsvn---a-sdmts---iynf
vptqrsak                                          evm prh r qtghett qglsrk dvsie
pipmge a                                          an  ec  g lsdf gd ae la   lkgd
aa laa                                                a   d dl         a        

       250       260       270       280       290       300       310       320
     .  :    :    .  .***:*:.. * . :         .                         :   :   :
srrtrvttlmvkvlahsqavts   v tlvv eavvskrlpnrrqesdgpdpelelelgeweasvrvdirqlvyfvatvi
ndykllsr srhi   qg ip    l  vit a tmlekplriniqnc                  q cgpistslvgr 
d qgi  en e   p   l         e   i aah kdgac a                     aen ql icdf 
   e    d     e   i         a   f       e                          d   d   a  

       330       340       350       360       370       380       390  
      *:    **                                                :         
nrtmht lvqsr  eptptpfytvns--esrrlverfgrwrsvrtvva-va----lvt---sfwsrvqyylg
vgrkep  rkq    ae clkehnklrswk lgrq  nnifntlmtltwl-gvsvitkiiem lrlrlslia
edqhae  heh     a akh edgdap a k q    g al glafg atf esfgi ddi fp kfpf  
  n  a  ed         a    e  a                       a  c  a caf al       
         a                                                   a  i       
© 1998-2022Legal notice