Dataset for protein BCL-2-like of organism Latimeria chalumnae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                *    .        .:
kmsfnrllvvdhisqklmqrgyqwrgyneqgsvppsprtpstqtpqd-dmaefrketlkllmds cenanceedeiafkf
                         evgaddhggggmplrgdpedge aipgmdppngshphag ngav glpagsss  
                                    dea eagc e                                  

        90       100       110       120       130       140       150       160
  .  *               ::* .*:.:  ..  :*..:..:*:*      . : :  :.:*.**. ****:*:::.*
eldgw qggkvlrppanplyram rv esiiakfhit sgmqqh n hkeddlhiiaqiadqi k  at    i sfiv 
 aqav  p   k                   l y   d   q         qs e vv e  r               

       170       180       190       200       210       220       230       240
...:. :  . :: . : .:    . :: ..   **  . **  :: :              .   .    ..*      
sgvvakklkkmnladsigqlidsivdfveqskgp  lhnq  kaiicffhnedaggarrf-rstiknmlmtva fffsfl
        m    s       e m    d n   qeq   at  hid  d m         ntr e lg v       

  .:   :    ::  .
lr    n k      r 
© 1998-2022Legal notice