Dataset for protein Bcl-xL of organism Gasterosteus aculeatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
  . ***** *::.*****.* * . :  .:. .** *.   .*:   **:: .:       ** ....*      *.:.
mani     e fin     k h lnhigledagg  e dkaag aggg  asagngtfngts  mppap llqqrs psa

        90       100       110       120       130       140       150       160
. :*** **.******** ::.*****  ** :** ***:**:.******.*******:********.******:*:*: 
dld   a  q        lfaq     hl  di  a   h  ed      k       i        a      d d se

       170       180       190       200       210       220       230   
**.**.:*** ***:**..***.****   :**                                        
  g  ad   l   e  qa   n    dcfa  fgrdgaaaarrsqetmrrwllvgvallmgvlvgmvmvkkr
© 1998-2020Legal notice