Dataset for protein Bcl-2 of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220       230       240
****************************:      *.           *  ** ::      .*:* *  :: .*..   
                            dacqalt pqemfsggwtih gr  fdfcvsragn f e allsla tgdkd

       250       260       270       280     
     .:  * *.*                               
viacipiga l h sreaeiqsqcrppcmllhlleiqvpvlflse
© 1998-2020Legal notice