Dataset for protein BCL-2-like of organism Cavia porcellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                :       .                                       
               mehtggsgppteaedlg lpep laqd lcpqfqlp  agksgspp tepgrns leingeedwl
                aa aamcm      de ih   g    e hl gd       egae  alemep aaeeed a h
                     cal      a  eg                      d                      

        90       100       110       120       130       140       150       160
                                     .:.  .  ..      :     .: :         :       
tspplplisltlhsssad kdsi lagcgttsrvvskv  em  g sleheqr kgwsdk  len ed rki nr sele
lrd  eia aagaqqa           ae s p lle     d  e f  d ae aa       d  qg  e  mdk 
                            d                                      k   a   a  

       170       180       190       200       210       220       230       240
* .*  ****:*::: **. :            :     :   :.  :      *: .. **                  
 sg pt    l tliv  aavlkklpsrpqsvdirtykqvsysvatfivshmht lvssr  dt-velygnnali-srrl
 q  ii       i e   fmaah kriniesc g   plqsfivda mrskgp  rqq   ag taff dg he d   
 e             a    i     de  a   e   n  l    eh  eg  h    e         aa a   
                                      e          d  a                           

       250       260       270     
ln nvannltlsgwlvgl -mlq- lfyalr    
dk gi kfepkfa aafa  lg   ec  il    
   fe f  la     a         a  e     
© 1998-2022Legal notice