Dataset for protein Mcl-1 of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mfglq--aviglnlycg-aglg----------------------------------------------------------
-----rn----------g----agsggatppggrllatekeasaqrevgggeagaviggsagasppaalvpdarrvvrpp
   f   vl r     ewipp t    t                          v          s   t          
                 a    p                                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaevpdvtatpsrllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgepgngsstdgsl
          gscg cw                              r                   e    d       
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        . .  .    :             
--------------------------reqatgakdtkpmgrsgaasrkaletlrrvgdgvqrnhetafqgmlrkldikn-
pstpppaeeeedelyrqsleiisryl------------------------------sqsysnpkimts-----------k
                t          ll          d  e  ns       g ne cp lacfslpvwvcnv n  e
                                                         a  n      c     g      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .*                     ::.*   :. .                  * *      
ddvksls-----vfsdgvtnWgrivtlisfgafvakhlktinqesCieplaesi----------w--kqrgWdGfveffh
-------rvmvhlpcrrprr ---------------------hqk aagfcrcctdvlvrtkrd-lv-sss f ------
 n   fy     ----           s                                       ry r   isnkir
                                                                               a

       330       340       350  
....:....|....:....|....:....|..
                                
vedleggirnvllafa-vagvgaglaylir--
----------------g-------------hi
l         g     c     td  lsli  
                                
© 1998-2020Legal notice