Dataset for protein Mcl-1 of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mfglq--aviglnlycg-aglg----------------------------------------------------------
-----rn----------g----agsggatppggrllatekeasaqrevgggeagaviggsagasppaalvpdarrvvrpp
   f   vl r     ewipp t    t                          v          s   t          
                 a    p                                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaevpdvtatpsrllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgepgngsstdgsl
          gscg cw                              r                   e    d       
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        . .  .    :       :     
--------------------------reqatgakdtkpmgrsgaasrkaletlrrvgdgvqrnhetafqgmlrkldikn-
pstpppaeeeedelyrqsleiisryl------------------------------sqsysnpkimts------v----k
                t          ll          d  e  ns       g ne cp lacfslp wvcn  n  e
                                                         a  n      c     g      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   .     **    .
ddvksls---------gvtnwgrivtlisfgafvakhlktinqescieplaesi--vlvrtkrdw--kqrgwdGFveffh
-------rvmvhvfsd--------------------------------------tdlpc--p-r-lvhykcaa  crccw
 n   fy                    s                            --- r- -   r sr        r
                                                            g                   

       330       340       350  
....:....|....:....|....:....|..
  .  *                          
vedleGgirnvllafa-vagvgaglaylir--
srswf ----------g-------------hi
      isnkia    c     td  lsli  
          g                     
© 1998-2020Legal notice