Dataset for protein BCL-2-like of organism Amphiprion ocellaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 ms-------e----h-----g---                         -----r--g-a---svc-------vsasey
 anys  ni -k vsd   k    w                         sllrve edg nn ms gpwpttvrlceda
   ec         c         t                          fddp    a    dk d pk lln     

        90       100       110       120       130       140       150       160
     .                        :     ::   .   *  :               :  *::::        
smlenslnc--elqsdsetd---cp-gd-lmendtrqllrlfqqd tgmhkpf-hwneskllqtmer vedlldkhryay
lse-cprghsd---------vss-- --sv kragddm kqhlpr hs trt  yqcstd qrrlrs i           
 l-v ad eqa hpcsespqsdpie ihr   el q      ta   e  q   dl gp  ch  ak             
   c         l     a   ha                                 e       e             

       170       180       190       200       210       220       230       240
                          . *   ****: .:. * ..:.     .      :                 : 
ngminklslddrgddvsfvsavakslva rtt    vtsfvt taavaqylkarkgrenclgpgkqqelgqgpvncrlva
                           k  hl     ia  e   t  rq l qenttsq p               nls
                           g             c         a   d klg                 e  

       250       260       270       280       290       300       310       320
: :: **      *: .:..*: * ::                :     :       :                      
qeist  lseqrs lvknns dg vkf-rva-peltvsntlmalagfaglfmvlallltgla-l---rltensckdahis
dt am  neplsp  le   c c ly- -q-ssva rvwqtistvtaiaglglvsis---y-tvtqs           
    e  gg kn    d     a     d rnrd sf e spd  rkf    aagm  ri vfvllr             
    d      k                          c rd   m         a  la ta gk              

© 1998-2022Legal notice