Dataset for protein Bak1 of organism Gallus gallus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           ::..**.. .*        * 
-------------------------------------------------g-a---s---megnEGdppgAhrrrdshgRr
mtprghfalpergnqprskaaafpdrsspgrpaerqggsrghhersmqr-p-esh-isafqag  ssqa p------- l
 ga                                       a lgc m k yva                         
                                                a                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *    :*************************************************************************
pSreinaEDQVAQETEEVFRSYTFYRYQQEREEGGAEVPMDPEIMEIQQELGSTGSQVGRRLAIIGDDINKRYDAEFRHM
l plpls                                                                         
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LKSLQPTKENAYEYFTTIASSLFDSGINWGRVIALLGFGYCMAIHVYQQGITGFLRRIARYVTEFMLRNRIARWIAQQGG
                                                                                
                                                                                
                                                                                

       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
****************************   :                 :  
WVAALDLDNVYMKYMLVVLALVMVGHLVvrrf-----------------frp
                            qdflqrtsggkqcivcslryslly
                                                    
                                                    
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice