Dataset for protein BAX-like of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------mevlrrssvfaaevldvfd---------------------------------------------
mmvrteymasgrggsntliyshlqhlmsvy--ls-fceaclrtagpvatilpyhfrvlllkggfpqtrfgsmadgrggqn
       lndhptqqkqgssqyvgrilyi-vc--w                                             
         c    gdpdqepsraqgkgd fh wg                                             
                  m   g a gd                                                    
                  k                                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 . :         ::  .::    .    :  : .       .    ::   *  :.*.*:   
-----------rsltekelvtqskalcrdyilsrlnqnglg---wskteLnfsp---sntalaevsmvLlclgDeLeciq
peqeprgaaggn---gdsilevgtvvlqgfvyehvqrqedsnravtreqhggrqdeltdpkhkklaqc qqia s d---
           -vvvdgqpisedai-f-e  ia terp  kh  spd dlaa  qqggqvg iveq rk     nylr
           sdp      dtan  - a      a i  s                 t     s   w         
           d                                                          h         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *.  *  *.      . ..*: ** :**: *: .**.**::: .*  *  .             ..   : :*  
pslyrNvarQlnIsvamenmvsdaFigVAteIFsaGI-tWGkVVsmFavAgaLavdcvrqghpatvhilvdslgqfvRkf
----g ael rm nqsslcptrev mr  yn  ad vfn  r  alyyf cr vikalvtqildnirtiiswvldyl eq
 nv        l tdvqgsc q la  rd   t            hl  k ih vitan aei-qmpfectievi -h
              n    v         s                           reha   - -s    m      -
                             a                                  m              s
                                                                                

       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
:  ::                                                                
lvpWlkrrGGWvsf-----sk-----------------rfafasfvcvcagvgwgfeldallca-----
vysfireq---egvtkccl--ilgkhemhkkltfeiqq---rgtstwrtvam----vf-tvfvyyrmvr
 in vva-   --i   vvktdpnpe nwlssa  slkcsy--fpr-q----vlsv--v-a--irkkek
    -     e-        fc                itt---y-skvpfaagy tv-vl-ltv  
    k     d                           l cmywlim ecaf h  k   dhalr  
                                            h                  f     
© 1998-2020Legal notice