Dataset for protein BAX-like of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .   .    . ..* : :.  .  .    :  .  .     : :*.  *         .   
---------------mdgsgeqprgegptssEqvmqtgalllqgfiqeragriggetpel-aLdpvPqda------stkk
masgqgpgvprrssvfpdepsdsfervardt lifksyyvyrrrqepdaeapsarpdevvvs slq sstmgqvgrqlem
      mepl qecgeaa imaaedqs   k e a pkvfhahlla     aa paa  ma  qaa grd      e ai
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   : ..   ::   ::     :        : *  :*. :*. * :.**.**:*  ..  *.:       . ::  : 
lsecl-rrigdeldsnmqlqrmia----dsprevFfrvAadmFsdG-inWGrVVaLfyfaskLvlkalcakvpelirtim
irpsvyknydsqfqtsleslqvvtavdt----dy tki ssl es nft  k  s ygvgyr avhvyrrgqtgmvhqvv
 gddin  var  him  heppt     enay a la  ghi  a           la  ag   dcvqqal aflgalt
                                                                                

       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
    :* :.  :  *:  .***   *       *  .   :.        .            
gwtldF-lrerllgWiqdrGGWvtlLsl--gt-Pilrsvwvlva-----rfl-a-ff------
rfvve mvhktiat lrrq   tgv pyvv--g twqvsvlvsvlvslgqv-v-s--vwlpmr
dclg     hc  r  aq    dda kcffsnd gfntltifgn clf g vtrrltkskneg
                       a  d           hd  a      a  k a  il    
© 1998-2020Legal notice