Dataset for protein Egl-1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*  *::                    *     . .   . : ::                  *.:  :** *:*.*.   
M--Ltfass--ssdlll-mp---shfDfv---kpfy--neknmmfsdft-tssd----havtSsefadDSgFfDdSets-
 lm slt-tss------s--pst--y vistitvvcsnssnmilyfyysnsfq-legmvttd ddsle  e l s kiih
    lt-p t sifip s  snvc nqv  ss fcidn k fc ssq pacsfd  tcs   q           dadn
                      n    i           k d    eap d  l    s e                  d
                      l    d           f        h         d a                   
                                                c                               

        90       100       110       120       
....:....|....:....|....:....|....:....|....:..
   . . :**:::.:*** ***::**::     .:.:: *. *** *
-i-eigyeIGtklaaMCDdFDAqmMSysrs-stsrsllgRvlDFFaF
y-hstsrk  srivt   g   kl  fasypasdkgifs fy   i 
  tqraq   aq t    e       ntgvr     h lf     
  sk  k                     arecp     d i      
   d                         h  k     a        
                                               
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice