Dataset for protein Noxa of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       * . .. ******************
-------------------------------------------------------ArvrgnqPTSEAFGRSGCCFSSSLP
mrssgslgsrirgllesagweelvrsqprahqgltsgrcgqtrreelrgsfgppp aaaaga                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLNF
                                                                                

       170      
....:....|....:.
****************
RQKLLNLIAKLFRLGT
                
© 1998-2020Legal notice