Dataset for protein classical BH3-containing proteins of organism Seriola dumerili

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
              . : :                        * *.:                      .         
maanftisdsesepseqvegmemsqsqqtksvllrqtstgtrp r asqipgt--sssnkpqferlrstesreellqr--
              ka a egalfiqlegieqe ldshneklg l  ap gapawnpna     qhprg pkd eihayr
                    a     f  d  c g    di c     a a c  al       malc  aaa  f    

        90       100       110       120       130       140       150       160
                                ..                       . . .  :              .
negfglhtpgaphwvgpqfelsqgtkmemgdfeea relpsgkkagqelrqmsplfd klhqeafmkmhqn   g km h
e eaaa fea fe scd ea  p   e  f     ael       c     d      d    hae          

       170       180       190        
:    .          *: .                  
nqlswkwrltvallpl lphtkmtsqlnhhqnhthrte
hnkea m  am  fgf  k gelepggggghfc     
 h             a  d  aia eccaee       
© 1998-2020Legal notice