Dataset for protein classical BH3-containing proteins of organism Scophthalmus maximus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                : **.:* :*    *          . * *.*           *  .   *   : ... :**:
maanftisdsesepsedd  dd fe dphc rttfreikcedp e t gpalalnngml cgtaae ellfaanagf  h

        90       100       110       120       130       140       150       160
  :: . :. *:*:  . .**  :  :  *     :. * *  .    ****. :.*:*         *:  .    .* 
feahaelfgr e llghed  agsgmdga frgrrkqa p hsaaaci    qlig e dslldkgem ehkqaghan m

       170       180       190       200       210       220       230       240
::.  **       * **..  : * .  ...: **:*.                                         
hhgpl  rlaaall l  dhgela eggaghhea  k nakasgpqnrassvertvqamtnqftslppqqlpppangrlp

© 1998-2020Legal notice