Dataset for protein Noxa of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*******************                                         * :*: * .   :. :  :*
                   gpagtagtardqaglgigmqlhftrgkkllsssplalprgh ee ec rqlrcfgdkeif 

        90       100       110       120       130    
*. *                                       ::  .*.*.  
 ke paetfesdsqtlllrnltasktcirglqtriflrrctfhnfeak f ngt
© 1998-2022Legal notice