Dataset for protein Bad of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
*********************                                             *:  .:  :*    
                     agtmetrsrhssypagteedegmeeelspfrgrsrsappnlwaaq fgreiifl defe

       170       180       190       200     
gsfkgl rpksagtatqmrqsaswtriiqswwdrnlgkggstpsq
© 1998-2020Legal notice