Dataset for protein classical BH3-containing proteins of organism Poecilia reticulata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
              .  .        *        .              .   *   :      : . :          
mdakftisdsmpdpedrtfrsspntw snfqlikckea-tqtp-glqepdsgsp elrapeplrrlrgnai--pprrsss
           eae  e pdkhce gcapeagaed  gggg  ggal ndm   g  eag dl n e g         

        90       100       110       120       130       140       150       160
                                           :      .::.. :**       : :        . *
gyfsfdcdslpssplsphpvtadkttqtpsptgqvmnha-qimstfhlipefnvkqk  vqnpmgglviivrsntnqai 
                                        hfa heeeeed d   e  k g g a  fhpkresa  a 

       170       180       190       200       210       220       230       
         :. :.        .      ..             ::          :.     . .           
 aaaci lk  lf  a sigid eelqg ddagr    i                   cf ia eggadea      
© 1998-2021Legal notice