Dataset for protein Noxa of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*******************                                     *      *:.  *..: :      
                   gpagtardqagfgigmqlrftrgkkllssslsswpla erecae lqra dklcfstqeiw

        90       100       110       120       130     
                                       * .: :: ..*.*.  
rqtelpaetsesdiqtlllrnltasktcmrgllqksflr ckfhnfeek f ngt
© 1998-2022Legal notice