Dataset for protein Noxa of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*******************                                         * :*: *             
                   gpagtagtardqagfgigmqlhytrgkklvsssplvlprgh ee ec rsrvcystqeiwr

        90       100       110       120       130   
                         * :* : ..* :*.  *: : : : .. 
qtklpaetsesdsqtlllrnltask ci gfgdk ff qcl hlfaelfccgt
© 1998-2020Legal notice