Dataset for protein classical BH3-containing proteins of organism Loxodonta africana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                 gmpkp alvmthvdrqrsrmqgv llerksplsgrqaprtlmlqe gfnqsghepecdqgrpq
                  haen  d asec qp lqll   hfaqfkiepfpp gpq lfld ea  dded    ad gm
                            a     gp e   g  ke g    l a                        l

        90       100       110       120       130       140       150       160
 *                     .                                                        
- gaps--saveeleddvfqpsesvravssggf-srrstqqsqst-sgyvsqlsplttrtgrssyptssdrstttpsp-s
m qkmhywrs           q alfrrrp t-irqqlssllsrscpvwrlgafgvqlesrpgpwhmrqpkplsqtqssl
h celgpsqg           p  echcqg l gpgp ha gppp  lshgd aa ehdrdhalredgceekeqleld c
c   keckl            g  da  p     ldd f  f ld   hf       fcc g ea a a daagg e  a
    ea                      a     fa                                            

       170       180       190       200       210       220       230       240
                                                            :.  .* :            
spsqgvmlpcgvteepqrlfygnagyy-sapastrasqplrgqpppeq-qhrivv--gaefqcma klhrrt--rvr-r-
qf                     rnrs psmvpmqqgpgvpedlrenl    drqry-ir kals hiyqlqpwsrfqqs
pa                     ieqr el   fp ala ga  edgi     e qt  k   k  d qg hml a mpn
                         hh                            lc            f feg   ane

       250       260       270       
qkrnenht nqlsnffmhalrnpelhgllempp    
phqhadg     ck  hg ipagaeaaa a e     
h     a          a    a              
© 1998-2021Legal notice