Dataset for protein Bad of organism Latimeria chalumnae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************************************           :***
MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPNLQNPGPHQSHPPSHT-----------dNME
                                                                 gvygwvklrkrn   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ILGRPSSESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSFLGLPRPKSAGAAGEMVDESWWKKLI
                                                                                

       170       180    
....:....|....:....|....
***************         
RSLKGRGQPRDPPGQqgvsirgpd
               ---------
© 1998-2020Legal notice