Dataset for protein Noxa of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*******************                                        *      *:.  *..: :   
                   gpagtagtardqagfaigmqlrftrgkkllssslssspla erecae lqra dklcfstq

        90       100       110       120       130        
                                          * .: :: ..*.*.  
eiwrqtelpaetsesdiqtlllrnltasktcmrgllqksflr ckfhnfeek f ngt
© 1998-2020Legal notice