Dataset for protein Hrk of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         *******
-------------------------------------------------------------------------AAAQVAA
mcpcplhrgrgppavcacsagrlglrssaaqltaarlkalgdelhqrtmwrrrarsrrapapgalptywpwlc       

        90 
....:....|.
***********
LAAWLLGRRNL
           
© 1998-2020Legal notice