Dataset for protein classical BH3-containing proteins of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         *.        :      .  : .   . : :        
------------------------------------t---sDsgesrvmepdshnwstpgsesrcrtrstst--------
mdprqpnrsdgstavtatgesggdpppvgaamvstp-sssn gepreggreepsgqrptfrqqqvqpkhsqspgpalpqn
                               gaarf irdm dd ddff   g cgge eq ik fd g l         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *   ... :     :: .       :  .   :  .           .                   
---l--------lPrryssgyfrlnspshpstv-sdrevtqqrseetqtptgqvp--a--r-------------------
sgm-pvgvsvfrr llsgnarisyhfeaqfespyrplplrfkddtqepsgmeipmnr-rsklaeangsdlrthqqhgsdl
ndg gcfraeep  efra  g   d d  a l lg e  qadaa  agn  dga fh lq                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       . .         *.:*. :.*:*     :   *: .                        **         . 
-------qqppmqwvavkyGqqLrrigDqFnslllqvymRnvrvqgtp----h---ww-------slLFvrgriigsqgs
sssstqqsnalglsqekev rk qlms e hrhhdkleh krwsgiqlrrmp-sksdptvllcvlly  siqlteygnnh
        a aadma aci  e      d dne  egag hq na paiqlh ihq  rlaaamg    dh e a eg a

         
....:....
         
trs--h---
hnrht-stv
ge eg rhe
© 1998-2022Legal notice