Dataset for protein classical BH3-containing proteins of organism Acanthochromis polyacanthus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
            *                        . .. : .    *  .    .: :           :.*   : 
sssaaspsishg ttpggg--------------ikctsesnssgatpds vwsmrsmalpqtptilfy----ih psras
  m  kfaapda s  ee ad epvgaagvsak    g h   eeam sfa anl  f l s    asgr   nre  

        90       100       110       120       130       140       150       160
   :: :           .       :         :  .    ** :.   : :     .      *.           
ssylaadgelqakgeeeastsvpssglsprsltadpttwtpspy  viqrmsermdsllhrggpktv sahgelndcrsc
agt  e           dpt ga frakrks  k lqaakks  q  hal e ag adk emer  q           

       170       180       190       200        
     .                  * **                    
gqrkttatqshvvksla------- y  tvqerfcnnrvk--hthrne
     s rfmahsfa  ivcpcl  f  shc me eknhhes      
© 1998-2020Legal notice