Dataset for protein FPV039 of organism all

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9J5G4_FPV039-01 FPV039 protein OS=[Viruses] Fowlpox virus GN=FPV039 (length=175 residues).
MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDK
INWGRIITIIAFCAYYSKKVKQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNTASYCIFTASL
IIASLAVFKICSFYM
© 1998-2022Legal notice