Dataset for protein Unclassified of organism Teiidae poxvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A894ZZZ8_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Teiidae poxvirus 1 (length=176 residues).
MQSSIERGPKYTLLYDVINNYCTEYVTGMSRMKYVKDKEAYECVKLICEFVIQQNEKQFKHFLKNVRSQRRISSIFNSMI
EDCINWGRVMVMIAFTAYAVKYFTENDINMEEDLTVVVTDILSSKYGAWFEVEGYWKGIRTHKNNIKRFQTLKNIIKVSM
FVIATLVIVRFCFLLI
© 1998-2022Legal notice