Dataset for protein Unclassified of organism Mudlarkpox virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A891M0E3_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Mudlarkpox virus (length=175 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRA
AAFIITSLAVINLFL
© 1998-2022Legal notice