Dataset for protein Unclassified of organism Cheloniid poxvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A890ULX1_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Cheloniid poxvirus 1 (length=180 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCNNIRDNFQEIVSNT
IRDKITWGRIISIIAFGAYITKVFKEQGNDDLAYRMPDIVTESLLVKCRTWIITQDHWNGLHKYISSHEKFSYLTYYIKA
AAFIITSLAVANFFFVESHN
© 1998-2022Legal notice