Dataset for protein Unclassified of organism all

[Download (right click)]

17 sequence(s)

>gnl|bcl2dbpro|A0A3Q0T8Z8_unc070L-01 Putative 070L protein OS=[Eukaryota] Amphilophus citrinellus (length=242 residues).
MYAVQGYFVLCGKKYCLICACQEGEQHPAACTDMTCKVMDIVNMQLYIPPEPPLLFMGDTKHLLNQGLELDGTSILQLDP
DFTVLGDNANMVHLYNTIDTHQCFTCTLSLKDFVQGDTFLGEHIYHVYNNGIELLDKHRSTYEAMITQLPEVDEQLIIRL
ASFLFDDGIVNWGRIVSFIAFAAVASQMSHLCKEDWYVTGIGRAVANYLTERHLDWLVANGSWVREGVCVTVSVIILLHK
VT
>gnl|bcl2dbpro|A0A7M5X572_unc070L-01 Putative 070L protein OS=[Eukaryota] Clytia hemisphaerica (length=178 residues).
MSPARTDLIVDGEFYQRTKFLANYVLKKHHNHTQRTDRIGDKLYELCLDIKYKHDMFFENVGRELGLNQENFDELSKAVM
AEVLNGNCNFGRIVSIYAFSLALSDYCIKNNLGDKTESITTNVALSIQEHIEWFNNHGQWDGFLDHFTPQTVEDKVWRGM
MITTFGLGAVAGLIYAHS
>gnl|bcl2dbpro|A0A1B2IU77_unc097R-01 Putative 097R protein OS=[Viruses] Cod iridovirus (length=148 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTLYTMQWEGVNLEEVHASLLGDGVVHWGRVAAFMHICRYTVRT
FPSSMDRTEVALTKFIQDPKIYKHLREWTDRLGTDRLGTVGVIGRCLEWLRAGVITGVVLSLLSLLFS
>gnl|bcl2dbpro|A0A5B8P2Y9_unc097R-01 Putative 097R protein OS=[Viruses] Frog virus 3 (length=69 residues).
MVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPGQRLL
>gnl|bcl2dbpro|A0A0D3R3H7_unc097R-01 Putative 097R protein OS=[Viruses] German gecko ranavirus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAVFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGAIAGVIAGVIAGVVLSLLFS
>gnl|bcl2dbpro|A0A6F8X2N8_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus 2 (length=173 residues).
MSNKFETDTKYLIDAFFKEYFNSQESNDIILKTIKKEVNILFDKHRLVYSNMIIDISITTEIDILVKKTAESIFSDGLVN
WGRIISLITFGILIVEYLKTINNTDKITSVSTIISSYLIEHQKHWLIKNNAWIGLVDFFTVQTYTSPVKSLLTFFIVFMG
TGAMLYSAFNLTY
>gnl|bcl2dbpro|A0A6B9XM53_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus 4 (length=181 residues).
MYLNNINMSNEFETNTKQLVDTFFIKYFDLKESDDMILKIMKREVDNLFNKHRLVYVNMLTKIMTMNIEVEIFVKEIVEN
IFSDGLINWGRIISLITFGILIVDYLKMINMTDKIKTVSFIISSYLIEHQKQWLLENNAWTGLVDFFTVQDHTSHIKSPL
TLFIALISIGALLYSTFNLAH
>gnl|bcl2dbpro|A0A1B2RW88_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus Sa (length=178 residues).
MYISAPMSDKLEIDTKKLIDSIFNNSVENEDETLKVMKREINLLFDKHRRVYSNMIDEISSSKLGISAVMEDTIKKVFSD
GSINWGRIVSLITFGVLVADYLKTNDGEHEIVAVKDSISSYLINHQKEWLLKNNAWKGFVDFFQVTSNLPSIKSSLTVFI
ALISFGAVLYSFFNLTTF
>gnl|bcl2dbpro|A0A3P9D9X2_unc070L-01 Putative 070L protein OS=[Eukaryota] Maylandia zebra (length=162 residues).
MLSLQTTAAEVPMVTRVARTLFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECAYAIGVSIAAYITDNHMDWLAGTDGW
VGWLRSIRLVLGLWMLWKNKQTPPTQSILSADSEHFVSRGVVGKPCQPSAKSSPTGNPYRMRAQNLPDLEHSPTQRTVAE
CS
>gnl|bcl2dbpro|A0A669CUF8_unc070L-01 Putative 070L protein OS=[Eukaryota] Oreochromis niloticus (length=224 residues).
MVYVGGTRDKHHCYTCGLTLKDFVVGDTLLGEHIYHVYNKGMACRYIERKYSKGEILYILGKERYRRGQMAFPSLIDKAE
FGYSSVEGLYRCILCSATIFQSASLRVMKQAVREVLWKYRRQYAGMLSNQKSVEVHMVTKVAREMCSDGIINWGRIVSLV
AFGEVLCRALKTTLGRHCAHEVGGGFIELFDRPSGRNFLLIQGVLIIVLLGLSLFTFLPCTTMK
>gnl|bcl2dbpro|A0A286P9S2_unc070L-01 Putative 070L protein OS=[Eukaryota] Oryzias latipes (length=152 residues).
MDEEIRILIKGVLGHFVGRRQDFEVERPRCREAVNAMTRAVCEVLEVHRPKYTEMVSDLGDSFPDAAMVNVAKSLFEDGI
INWGRVVSLICLGAAVCQHQDRFSGSPGSLLADTVSEAIASYLLTEHRGWLEEMCWVSGLYSRGLNFMLSLL
>gnl|bcl2dbpro|A0A6M8PD54_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=145 residues).
MDVRQFLSDCEAPEAMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVITGVVLSLLLS
>gnl|bcl2dbpro|A0A6M8PGQ0_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=153 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVITGVITGVITGVITRVILSLLFS
>gnl|bcl2dbpro|A0A6M8PH27_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVITGVITGVILSLLFS
>gnl|bcl2dbpro|A0A6M8PUW7_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVIMGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A1B2IUH3_unc097R-01 Putative 097R protein OS=[Viruses] Ranavirus maximus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTMQWEGVNLEEVHASLLGDGVVHWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTDRLGTVGVIGRCLEWLRAGVITGVVLSLLSLLFS
>gnl|bcl2dbpro|A0A192GNS8_unc097R-01 Putative 097R protein OS=[Viruses] Short-finned eel ranavirus (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHVSLLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEAALTKFIQDPEIDENLREWTDRLGTVRAIGRCLEWLGAGVITGVVLSLLFS
© 1998-2022Legal notice