Dataset for protein iridoviridae of organism Tadpole virus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8F9RAB0_097R-01 097R protein OS=[Viruses] Tadpole virus 2 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
© 1998-2022Legal notice