Dataset for protein iridoviridae of organism Red eared slider ranavirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6M5K8N1_097R-01 097R protein OS=[Viruses] Red-eared slider ranavirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACVHLYTMLWEGINLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2021Legal notice