Dataset for protein Unclassified of organism Rana tigrina ranavirus

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A6M8PD54_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=145 residues).
MDVRQFLSDCEAPEAMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVITGVVLSLLLS
>gnl|bcl2dbpro|A0A6M8PGQ0_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=153 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVITGVITGVITGVITRVILSLLFS
>gnl|bcl2dbpro|A0A6M8PH27_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVITGVITGVILSLLFS
>gnl|bcl2dbpro|A0A6M8PUW7_unc097R-01 Putative 097R protein OS=[Viruses] Rana tigrina ranavirus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVIMGVITGVVLSLLFS
© 1998-2021Legal notice