Dataset for protein Unclassified of organism Oryzias sinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C7YAE9_unc070L-01 Putative 070L protein OS=[Eukaryota] Oryzias sinensis (length=196 residues).
VPVTRSLQREPLCTDSDEMKYQSPRLNSKSPRLACSFVVCLVFSSYSFLFTPLCDQRENHRALRFEEQSSQHKQIYLGDS
FPDAAMVNVAKSLFEDGIINWGRVVSLICLGAAVCQHQDRFSGSPGSLLADTVSEAIASYLLTEHRGWLEEMCWVSGLYS
RGVELHAIAVMKQFVFMFCFFFFSVPLSVLFLTLSS
© 1998-2023Legal notice